PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT33086
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family MYB_related
Protein Properties Length: 331aa    MW: 36192.8 Da    PI: 6.0506
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT33086genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding38.52.7e-122872147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r +WT+ E++++++a +++  + Wk+I + +g  +t  q++s+ qky
         EMT33086 28 RESWTEPEHDKFLEALQLFDRD-WKKIEAFVG-SKTVIQIRSHAQKY 72
                     789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.36E-162278IPR009057Homeodomain-like
PROSITE profilePS5129414.182377IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.1E-62678IPR009057Homeodomain-like
TIGRFAMsTIGR015571.6E-182675IPR006447Myb domain, plants
SMARTSM007176.5E-102775IPR001005SANT/Myb domain
PfamPF002494.9E-102872IPR001005SANT/Myb domain
CDDcd001671.33E-73073No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MAVPADAAAA AEDARMKVRK PYTITKSRES WTEPEHDKFL EALQLFDRDW KKIEAFVGSK  60
TVIQIRSHAQ KYFLKVQKNG TGEHLPPPRP KRKAAHPYPQ KASKTAPVAP QAVLSQQPAP  120
PPPPPREQDG VDVSMDASMV VPNTNANAVV PSWDNALVQP TQVTSAIATN NCSSSIESQS  180
GTWPTSEAVE QENVLPQMRA MPDFSQVYNF LGSVFDPDTT GHLQRLKAMD PIDVETVLLL  240
MRNLSVNLIN PEFEAHQVSV SAMEAHQRQL LSSYGSGGDE NKPEGMENFG SQSSHLPSIS  300
GGTLKSVDLV SASELKQEHQ LVGLIKANEK D
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00625PBMTransfer from PK02532.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3606960.0AK360696.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1123J21.
GenBankAK3769560.0AK376956.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3144K07.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010240580.11e-159PREDICTED: protein REVEILLE 6-like isoform X1
SwissprotQ8H0W34e-92RVE6_ARATH; Protein REVEILLE 6
TrEMBLM8D9750.0M8D975_AEGTA; Myb-like protein G
STRINGBRADI1G32330.11e-159(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP109638111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52660.11e-74MYB_related family protein